Exercises for developing attention in younger schoolchildren. Educational portal
Letter for you!
Goals: development of attention, memory, thinking; acquaintance with the summary of popular children's books.
Description. The teacher reads a letter from a fairy-tale hero without naming him. The children's task is to remember the name of the author of the letter.
Option 1
“Hello, boys and girls, my young friends! I'm sure we know each other.
I'll tell you about my life. I lived very poorly, barely making ends meet, but one day I learned a magic word with which you can get into a cave where robbers kept countless treasures. I am a modest person and took only three bags of gold, although the treasures were more than enough to decorate a hundred royal palaces.
The chieftain of the robbers decided to take revenge on me - in the eastern city there is nothing easier than finding out about someone who has recently become rich. The robbers came up with an insidious plan to get even with me, but thanks to a faithful maid, I managed to avoid a sad fate.
Say my name! (Ali Baba.)
Option 2
“Good afternoon, children!
I'll tell you about myself. I am a poor girl, from a fairy tale by the Brothers Grimm. My evil stepmother decided to destroy me, because she wanted to be the first beauty in the world and could not allow me to surpass her in beauty. Fortunately, my stepmother’s servant, who was assigned to kill me, turned out to be a kind man and saved my life. And then I found shelter in the house of seven dwarves.
My new friends worked as miners in the mountains, and I was busy with housework. We were very good together, but the magic mirror that my stepmother had told her that I was still alive. And the evil woman did not calm down until she found our forest hut and treated me to a poisoned apple. As soon as I took a bite, I fell to the ground dead.
The dwarves were very sad about me. Shedding bitter tears, they put me in a glass coffin, which they left standing on a high mountain. There the handsome prince saw me. He fell in love with me and persuaded the dwarves to let him take me with him. And on the way to the palace, a miracle happened: due to the road shaking, a piece of a poisoned apple, which, fortunately, I did not have time to swallow, fell out of my throat, and I came to life. That was joy!
Do you guys recognize me? (Snow White.)
Option 3
"Hello guys! You have probably heard about me, since I am the heroine of a Russian folk tale. Should I tell you about myself?
I lived with my mother and father, I did not know grief, and after the death of my dear mother, my father married another, thought to give me a new mother, but he gave me an evil stepmother.
The stepmother had two daughters, evil, bad and picky. My stepmother loved and cherished them, but they all tormented me with work, scolded and scolded me. Only I was getting prettier and prettier every day.
One day, when the fire went out in our house, they sent me to Baba Yaga, my stepmother’s relative, for fire. I thought that I would never come back, because Baba Yaga eats and chews people, only the bones crunch. If it weren’t for the magic doll that my mother gave me before her death, and not for the black girl who worked around the house for Baba Yaga, I would never have returned home.
I didn’t meet the prince, like Cinderella, no one awarded me gold, but still the fairy tale ended very happily for me.
So what’s my name?” (Vasilisa the Beautiful.)
Option 4
“My little friends, you, of course, know me!
I was born from a magical grain of barley. It was magical because my named mother grew from it not barley, but a beautiful tulip. When the flower bud blossomed, it turned out that I was sitting in the middle of the tulip. The kind woman took great care of me. I was born for happiness. How scared and sad I became when the old toad decided to marry me off to her nasty son! Luckily, cute little fish saved me.
Then a new disappointment awaited me - the cockchafers did not want to accept me into their society. They thought I was ugly because I didn't look like them.
When winter began, I found shelter in the hole of an old field mouse. She was kind and only wanted the best for me, and therefore thought that it would be just wonderful if I married her mole neighbor. But if I became the wife of a mole, I would be forever deprived of sunlight and warmth. Fortunately, I managed to save a cute chirping swallow from death, who, out of gratitude, took me to the blessed warm lands. There I made friends with beautiful elves and, having married the most beautiful of them, became the queen of flowers. And for my wedding, the elves gave me transparent wings. They gave me a new name - Maya.
What was my name at first?” (Thumbelina.)
Option 5
“In Stockholm, on the most ordinary street, in the most ordinary house, lives the most ordinary family named Svanteson: dad, mom, Baby, his older brother Bosse and his older sister Bethan. Why did they become the heroes of a fairy tale by a famous Swedish writer?
I will say without modesty: solely because of me. After all, I am an incomparable man in the prime of his life! And even with a propeller: look, I press a button located on my stomach, the propeller blades begin to rotate... Oops! Now you can have some fun!
Oh! Something fell here... It shattered... Calm! Only peace! It's an everyday matter. And for me personally it’s time to go home. I, you know, live on the roof. The path is not short, and you will somehow clean up and figure it out without me...
I really fell in love with the Kid, we had a lot of fun with him, you know. Therefore, the book about us turned out to be very thick and cheerful. After all, I love making jokes on people, and, mind you, I never repeat the same joke twice. Guess who is the best joker in the world? I’m also the best nanny in the world, the best fireman in the world, an inventor, a dog breeder, a magician, the best grandson in the world and a pie fighter (by the way, Miss Bok is right in saying that flour spoils your appetite).
Who am I? (Carlson.)
Option 6
“In some families, nannies are invited to care for children, who are also called teachers or governesses. They look after young children and help parents raise them. I am one of the most wonderful governesses in the world - the heroine of a fairy tale by an English writer.
The lives of little Londoners Jane, Michael, John and Barbara changed dramatically when a new nanny appeared in the Banks family home.
The children immediately guessed that I was extraordinary. Not only that, I was carried by the east wind! Imagine that I rode along the railing of the stairs to the second floor (adults say that you can’t slide down the railing, and this is true, but they don’t forbid anyone to climb up them, since this is completely impossible). And then - I have a magic carpet bag from which I take out all sorts of different things, although this bag seems completely empty. And the main thing is that I have a lot of amazing friends.
As you read the book about the little Bankses, you will become part of incredible adventures before I, the wonderful and mysterious nanny, flies away, caught by the west wind.
Be sure to read Pamela Travers's book About Me. Now say my name." (Mary Poppins.)
Option 7
"Hello guys! You've probably heard of me. I'm small and ugly. Only my heart is kind and brave, and if I undertake to help someone, I will definitely see it through to the end.
My master is Ivan. I served him no worse than Sivka-Burka served his master. Together with Ivan, we got the magical Firebird, whose feathers all seem to burn with fire, and brought it to the king. Then, by royal order, they found and brought the beautiful Tsar Maiden to the palace, then went in search of her ring, which lay in a chest at the bottom of the ocean. To do this, we had to go up to heaven and visit the palace of the Tsar Maiden, where Mesyats Mesyatsovich rests during the day, and the Sun itself at night, and then the miracle Yudo the fish-whale and other inhabitants of the sea waters helped us get the ring. And most importantly, thanks to me, Ivanushka escaped the cruel death to which he
sentenced the ungrateful king, and turned into such a handsome man that he could neither be told in a fairy tale nor described with a pen.
Did you guess my name?” (The Little Humpbacked Horse.)
Option 8
“The Belgian writer Maurice Maeterlinck spoke about us, brother and sister, in the play “The Blue Bird,” which adults liked so much that they turned it into a wonderful Christmas fairy tale. Why Christmas? Yes, because the action takes place around Christmas.
If you saw us, you would decide that your brother is Thumb, he looks so much like him, and you would definitely mistake your sister for Little Red Riding Hood. Our father is a woodcutter. Like all children in the world, we really love to receive gifts and eat sweets, but we rarely manage to do this, since our father is very poor. And they wrote a book about us because the most incredible fairy-tale adventures happened to us.
Our fairy neighbor's granddaughter fell ill, and this fairy asked us to go to a magical land to find the Blue Bird - only she could help the poor girl recover. We walked around the entire magical land, visited the Land of Memories and the Kingdom of the Future, but we could not find the magical Blue Bird.
We were very sad because we passionately wanted to help the sick girl. We had a bird at home. We loved her very much, but still decided to give the bird to the girl, because we thought: what if this bird will be able to help the sick? The most amazing thing is that when we gave the girl our bird, it suddenly changed color and turned blue!
We looked for the Blue Bird in distant magical lands, but it turned out that she was nearby!
Say our names." (Tyltil and Mytil.)
Word game
Target: development of attention, thinking.
Description. The teacher invites children to decipher words made up of the letters of a given word using a code.
The word "candy"
Encrypted words:
e) S F Q W S R.
Answers: a) vaga; b) grass; c) skin; d) joke; d) jacket.
The word "platform"
Encrypted words:
Answers: a) container; b) dad; c) shovel; d) ladder; d) grater.
The letters fell apart
Target: development of attention and thinking.
Description. Children are asked to assemble words on a given topic from “scattered” letters.
Female names
RIIAN, LYAANAT, RILAAS, AGOL, TEEKANARI, NA-OKAS, ENEAL, AANN, RIMAYA, KIVROTIA.
Answer: Irina, Natalya, Larisa, Olga, Ekaterina, Oksana, Elena, Anna, Maria, Victoria.
Male names
DIVAM, NANOTH, DANREY, TOILINAA, IRYGO, IRYUY, IMAKHIL, LEVAYIR, SOBIR, GIGIROY.
Answer: Vadim, Anton, Andrey, Anatoly, Igor, Yuri, Mikhail, Valery, Boris, Grigory.
Academic disciplines
TURALIRATE, TEMAMAKATI, VEDEPRIDOROENI, ZIF-TURALKU, LOGYAINOHET, SOIRVAENI, OOZYALOGI, EOG-FIYARAG, KAFIIZ, ZUMYAK.
Answer: literature, mathematics, natural history, physical education, technology, drawing, zoology, geography, physics, music.
Animals
RESAB, TROCKER, TWO, RILKOK, VOKORA, YANIVS, FIZHAR, GOBETHEM, RACIOLIK.
Answer: zebra, rat, bear, rabbit, cow, pig, giraffe, hippopotamus, crocodile.
Bed dress
USHPODAK, VOLONACHKA, TYNYAROPS, PODOLNIKDEYA, OLOYADE, MARSTA, PELD, VIKPERYE, FYATYUK, NIRAPE.
Answer: pillow, pillowcase, sheet, duvet cover, blanket, mattress, blanket, feather bed, mattress, feather bed.
Tools
LAIP, POLATA, OKSA, OTPOR, GRILAB, GLUP, SHELIK, BANRUOK, KALEI, OMLOKOT, LIVY.
Answer: saw, shovel, scythe, axe, rake, plow, pliers, plane, watering can, hammer, pitchfork.
Sport equipment
KINSA, KIKON, IZHLY, KHAMATYSH, YACHM, SHLUKAK, LOVESDEIP, TENGALI, KAKASLAK.
Answer: sleds, skates, skis, chess, ball, stick, bicycle, dumbbells, jump rope.
Furniture
LOCKERS, NADIV, OVKRAT, BUTARET, OLST, TUSL, KAFSH, BOKACHMUT, FETUB, MOKOD.
Answer: armchair, sofa, bed, stool, table, chair, wardrobe, bedside table, sideboard, chest of drawers.
Confusion
Target: development of attention and logical thinking.
Description. The words spoken by the characters in the work are written in random order on the board. The teacher reads the text, stopping in those places where the speech of the characters should be heard. After re-reading, children substitute words that are suitable in meaning.
Words of the main characters
. “Tell me: what would you do that you should not do if the donkey were not immediately returned to you?”
. “What would I do? I would buy myself another donkey. But now tell me: would it be reasonable with my skinny wallet?”
. “If the donkey is not brought to me immediately, something terrible will happen, I will do something that I should not do.”
Text
The mullah's donkey was stolen. The angry victim runs through the bazaar and shouts at the top of his lungs: _______
The crowd of curious people is noticeably frightened by these words, and suddenly the donkey appears near the mullah, although no one saw who brought him. Nevertheless, everyone is glad that the matter ended so successfully. But then one respectable man asks the mullah: _________
Then the mullah replied: ________
(Eastern history.)
Error!
Target: development of attention, memory, thinking.
Description. Children are invited to find an error in the Russian proverb (if there is one) and correct it.
Business takes time, fun takes a minute. (Hour.)
A saying is a flower, a proverb is a seed. (Berry.)
The bird that doesn't like its nest is stupid. (Not nice.)
The day is long until the evening, when there is nothing to eat. (Do.)
One mind is good, but two is ugly. (Better.)
You can't smear the porridge with oil. (You'll ruin it.)
You can’t even pull a pike out of a pond without difficulty. (Fish.)
And St. Petersburg was not built right away. (Moscow.)
Don't say "yay" until you've jumped over. (“Gop.”)
In close quarters, but not in ambush. (Offended.)
Chickens are counted in the spring. (In autumn.)
Finished the job - rest safely. (Go for a walk.)
Measure seven times - cut seven times. (One.)
Learning is light, and ignorance is darkness. (Dark.)
The spool is small, but it will still be useful. (Dear.)
If you don't have a friend, look for him, but if you find him, take care of him. (That's right.)
Drinking tea is not burning wood. (Chop.)
It will be spring on our street. (Holiday.)
You over-salted the porridge yourself, so you can disentangle it yourself. (Brewed.)
Every man to his own taste. (That's right.)
If you love to ride, you also love to carry a sled. (Carry.)
Labor feeds, but laziness does not. (Port.)
Moscow is the capital of all cities. (Mother.)
Fear has big eyes. (Great.)
It's good at a party, but bad at home. (Better.)
Don't rush with your feet, hurry with your actions. (Tongue.)
Once you lied, another time you lie too. (They won't believe it.)
The cowardly bunny gets a stump from the wolf. (That's right.)
He who undertakes everything succeeds in everything. (Nothing works.)
The pear does not fall far from the apple tree. (Apple.)
Money can't help my grief. (With tears.)
They do not look at a given horse's teeth. (That's right.)
What goes around comes around. (You will reap.)
You can't put a scarf over someone else's mouth. (That's right.)
Murka knows whose meat she ate. (Cat.)
Life is given for extreme things. (Kind.)
Out of boredom, pick up an ax. (Case.)
Pick one berry at a time and you'll get a jug. (Body.)
Two are plowing, and the rest are waving their hands. (Seven.)
If you chase three birds with one stone, you won’t catch a single one. (Two.)
Don't put off until tomorrow what you want to do today. (Can.)
Learning to read and write is always useful. (That's right.)
An old friend is better than two friends. (New two.)
The word got lost!
Target: development of attention, memory, thinking.
Description. Among the words in each line there is one that was not discussed in this tale. The children's task is to find out this word and also name the fairy tale.
Gerda, Kai, roses, sleigh, kiss, eternity, key. (“The Snow Queen”, H.-C. Andersen.)
Flour, dough, window, wolf, hare, fox, rooster, grandfather, woman. (“Kolobok.”)
King, queen, pumpkin, fairies, feast, gifts, sixteenth birthday, spindle, dream. (“Sleeping Beauty”, C. Perrault.)
Godfather Pumpkin, Professor Pear, Countess Cherry, little Cherry, King Pea, Master Grape, maid Strawberry, Prince Lemon, Signor Tomato. (“Cipollino”, D. Rodari.)
Princess, kingdom, rain, feather beds, pea, walking boots, prince. (“The Princess and the Pea”, H.-C. Andersen.)
Pies, apples, river, sister, mash, wolf, hut on chicken legs, Baba Yaga. ("Swan geese".)
Masha, forest, hut, chair, fox, spoon, bowl, bed. ("Three Bears".)
Girl, box, pie, egg, stump, bear. ("Masha and the Bear".)
Mom, grandmother, girl, hare, wolf, basket, pies, forest. (“Little Red Riding Hood”, C. Perrault.)
Alyonushka, Ivanushka, falcon, hoof print, kid, merchant, witch. (“Sister Alyonushka and brother Ivanushka.”)
Grandfather, woman, girl, Kashchei the Immortal, fire, snow, cloud. ("Snow Maiden".)
Signor Tomato, Karabas Barabas, Tortila, Malvina, Pierrot, Artemon, Duremar. (“The Golden Key, or The Adventures of Buratino”, A. Tolstoy.)
A tail, a balloon, bees, honey, condensed milk, a mirror, a gun. (“Winnie the Pooh and all-all-all”, A. Milne.)
Mole, swallow, ghost, elves, mouse, chafers, toad. (“Thumbelina”, H.-C. Andersen.)
Grandfather, woman, granddaughter, sleigh, fish, fox, wolf, cart, tail. (“The Fox and the Wolf.”)
Stepmother, sisters, prince, astrologer, king, fairy, watch, shoe. (“Cinderella”, Ch. Perrault.)
Orphan, cow, One-Eyed, Two-Eyed, Three-Eyed, apple tree, sorcerer. (“Khavroshechka.”)
Buns, jam, boy, ghost, housekeeper, motor, kikimora. (“Baby and Carlson”, A. Lindgren.)
Mill, magic lamp, donkey, king, princess, cat, boots, ogre. (“Puss in Boots”, Ch. Perrault.)
Barmaley, Ava, Bumba, genie, Kika, Chichi, Tanya, Vanya. (“The Adventures of Doctor Aibolit”, K.I. Chukovsky.)
Van, girl, Gingema, Bastinda, Totoshka, Goodwin, merman. (“The Wizard of the Emerald City”, A. Volkov.)
Donkey, dog, cat, rooster, elephant, musicians, robbers. (“Musicians of Bremen”, Brothers Grimm.)
Village, buckets, pike, stove, king, Nesmeyana, gnome. ("By magic".)
Trough, dugout, seine, sea, old woman, old man, granddaughter. (“The Tale of the Fisherman and the Fish”, A. Pushkin.)
Attentiveness and good memory are the basis for successful schooling. These qualities can and should be developed at any age, and every parent should help their child with this.
How to develop memory and attention in a schoolchild? The exercises below should be performed regularly, but unobtrusively. A little student should not be tired, tired, or in a bad mood. Otherwise, there will be no result from the classes.
Reading- a universal way to develop memory, literacy, and attentiveness. What you read should be retold or memorized. It is necessary to use not only visual, but also auditory memory. Voiced phrases and sentences are easier and faster to remember. The child can read aloud or listen to the parent.
Games- will help the student develop in an interesting and exciting way. Chess, checkers, backgammon and even cards require concentration, activate memory and form logic. Well-known and popular board games, such as Monopoly or Mafia, have a positive effect on the intellectual development of a child.
If you don’t have the necessary equipment, you can get by with your imagination. “Cities” (the parent and child alternately name the cities), “Guess the Animal” (one of the players shows the animal, the other guesses) and many other speech games will help the little person spend time profitably.
Language learning– one of the best exercises for the brain. The need to assimilate new information forces the hemispheres to actively work and use additional memory reserves. In the future, knowledge of a foreign language (or even several) will definitely be useful to the student.
Crosswords– the excitement associated with completing the activity is intertwined with the need to remember, answer questions, and guess.
Mental arithmetic– not only develops mathematical abilities, but also promotes the development of ideas, visual memory, and forms the imagination. You should start with the simplest examples, gradually complicating the tasks. It’s especially easy for schoolchildren to count money, which parents should take advantage of. Let the child count the change in the store, the amount of food in the basket, the cost of bus travel for the whole family.
In order to avoid childhood absent-mindedness, adults must ensure that the following conditions are met:
- The student must sleep fully (at least 8-9 hours a day);
- the distribution of physical and mental stress should be even;
- playing sports promotes active access of oxygen to the brain, which has a positive effect on well-being, memory and attentiveness;
- After school, the child needs rest (at least 2-3 hours).
The development of memory, attentiveness and intelligence will help the student avoid problems in school.
You might also like:
A child asks to go home from children's camp - what should parents do?
How to teach a child to write correctly in a notebook and indent the lines of a cell
How to teach a child to write quickly from dictation
How to train and develop diction and voice in a child
How to develop logical thinking in a child 8-9-10 years old
How to explain fractions to a child: 3-4 grade. Where to begin?
How to teach a child to fantasize and dream?
Very often, parents of elementary school students are faced with the need to develop attentiveness in their child. After all, successful learning will not work without this. Due to age characteristics, it is still difficult for a child of 7-8 years to concentrate his attention for a long time. However, students who already cope with this solve the tasks set by the teacher much faster and easier. Special games and interesting exercises can help develop mindfulness.
What is attention like?
It is customary to distinguish three types of attention:
- Involuntary- appears unexpectedly, on its own. This is a response to something that is bright, catchy, makes a lot of noise, arouses interest, but quickly disappears as soon as the object becomes ordinary. This type of attention predominates in children under 7 years of age.
- free attention - the baby learns to control himself, doing not what is interesting to him at the moment, but what is necessary. He learns to focus on the task at hand. When starting school, voluntary attention begins to develop.
- Post-voluntary attention appears when the baby is already carried away by the task and does not need any effort to concentrate on it.
Attention is also divided into visual, auditory and motor-motor.
To develop each of these types, you can select appropriate games and exercises.
Features of conducting classes
- Choose the right time. You should not distract your baby if he is passionate about something. It's better to wait until he finishes his activities.
- Ask your household members not to disturb you and your baby during the lesson.
- Before starting class, let your child fulfill basic needs: drink, go to the toilet, put away toys.
- Use non-standard methods to captivate your baby. It is better if they are accompanied by a lot of positive emotions on your part. Exercises should be interesting, understandable and accessible.
- Start with step-by-step instructions to follow. Make sure your child completes each task to the end.
- Control your emotions. Classes should be held in a friendly atmosphere. You should not criticize your child, scold him, or raise your voice at him. Encourage, praise, smile, say kind words, provide the necessary help if required.
- All mental functions are interconnected. The better a child’s speech and memory are developed, the easier it will be for him to concentrate on anything. Therefore, it is necessary to take care not only of the development of the baby’s attentiveness, but also of his general intellectual development - train memory, develop speech.
- Systematic and regular training is very important. You are unlikely to achieve success by practicing “once in a while.”
Useful games and exercises
To increase concentration.
Correction test
Offer your child a piece of paper with text printed on it. The font should be large. Ask your child to find as many of the same letters in the text as possible (for example, the letter “a”) and cross them out with a pencil. The task is completed for a while. A child 7-8 years old should have time to look through 350-400 characters in 5 minutes and should make no more than 10 mistakes. At the same time, the parent must control the baby, making sure that he searches strictly line by line. You need to devote 7-10 minutes to exercise every day. Gradually it can be made more difficult by increasing the number of letters to 5.
Encrypted letter
The baby is offered a sheet of paper with a set of letters of the Russian alphabet. You need to find words among them.
IPAODROTPMAMANGSHGSHLDPSVASHLRPACKETYKPOOOPSRKYUTSYYYYEYESHIANISVZHSFUTORAKRLOZHKATMVSVROSHVYVCHSMYUYUDMILKONUCTSYAYIMVNLSHDSVRODJJV
- Labyrinths of different difficulty levels.
- Graphic dictations - drawings in cells.
The following games develop motor-motor attentiveness and the ability to switch.
Game “Edible-Inedible”
The presenter’s task is to throw the ball to the players while calling out the words. If the presenter names an edible object, then the player needs to catch the ball, but if it is inedible, the ball is pushed away.
Piano
Players sit next to each other and place their hands on the knees of their neighbors to the right and left. You need to alternately clap your palms at a given pace. The first and last players tap the knee twice and play continues in reverse order. A player who misses his clap or loses his tempo is eliminated from the game.
Forbidden Movement
At the beginning of the game, all players agree on some movement that will be prohibited, i.e. it cannot be repeated. Next, the presenter quickly shows the players various movements that they must repeat after him. The player who repeated the forbidden movement becomes the leader.
Game "Floor-nose-ceiling"
Ask your child to point to what you name. Name and show with him. When your child begins to easily cope with a task at a fast pace, make it more difficult. Now you can name one thing and show another. It should only show what you say.
For auditory attentiveness:
Find a match
You need to take an even number of identical opaque bottles. Fill them in pairs with different contents. For example, two bottles - with sand, two more - with small stones, two more - with rice, the next ones can be filled with coins, various cereals - peas, beans, semolina, twigs, rustling candy wrappers. There are many options you can come up with. Take yourself one bottle with each filler, and give the other bottles to your baby. Shake one of your bottles; your baby should listen carefully to the sound it makes. Now ask your child to find a match among his bottles based on the sound of yours.
Young children can be asked to find identical mittens.
Clapping
Ask your baby to clap the suggested rhythm after you. Gradually make the task more difficult.
Guess the sounding object
Show your child the sounds of different objects. These can be wooden spoons, rattles, various musical instruments. Now ask him to turn around and guess what it sounds like.
Visual attentiveness develops:
Remember and tell
Place 5 different toys in front of your baby and ask him to remember them. Ask your baby to turn away or close his eyes and hide one of the toys at this time. After the baby opens his eyes, he must name which toy is missing. Gradually complicate the task by increasing the number of toys to 10. This game can be played in another version. The toy should not be hidden, but their order should be swapped.
Didactic game “Paired pictures”
With the help of such a game, the child will quickly learn to look for similar pictures. Playing is the best way to learn some rules, poems and develop attention with your child. But! As soon as the child gets tired, the game should be stopped and continued after a few hours or the next day.
Repeat the sequence
Cut out various geometric shapes from colored cardboard. They should differ in shape, color and size. Now lay out a certain sequence of them in front of the child and ask him to remember. Next, you need to mix all the figures into one pile and ask the baby to repeat the sequence that was in front of him. Start with 5 figures. Gradually complicate the task by increasing their number.
12 years is the age when a child’s learning abilities are almost at their highest level. That is why parents should not stop there: your task is to develop the child intellectually further. How to do this - read on.
How to develop attention in a child
How to develop attentiveness in a 12 year old child? To do this, you can perform special exercises that train this skill. The set of mindfulness classes for children 12 years old includes the following exercises:
- "Don't get lost." The exercise develops concentration and teaches how to distribute it correctly. Let the child count out loud, for example, from 1 to 31, but do not include numbers with the number 3 in the count. Instead, he should say “I won’t get lost.”
- "Observation". This exercise helps develop visual memory. The child needs to describe from memory the details of the way to school, the yard near the house, his room or class. In general, any place he happens to be. The description is done orally.
- "Fly". This exercise is also aimed at developing concentration. It is carried out in a playful way.
To complete it, you need to take a board and draw a field with 3x3 cells on it. You will also need a piece of plasticine. He will play the role of a fly. Now place the board vertically and let the child move the fly around the squares in accordance with the commands you give him. For example: “right”, “left”, “up”, “down”. The starting position of the fly is a square in the center of the board.
How to develop attentiveness in a schoolchild is written in specialized literature on child development and popular psychology.
How to improve memory in a 12 year old child
How to develop memory in a 12 year old child? To do this, you need to focus on several aspects.
If a 12-year-old child has a poor memory, he should read a lot. Don’t let your children sit for a long time at the computer; it’s better to interest them in a good book, show by example that reading should become an integral part of life for a child.
Effectively train your memory and develop new skills. If a child learns a new sport or starts playing some musical instruments, this will help him cope with the problem of poor memory. Another option for improving memory and attention in a schoolchild is to let your son or daughter learn poems and passages from prose works by heart. Also be sure to increase your child’s vocabulary. You can do this with the help of board games like Scrabble.
Among other things, memorizing numbers is good for memory development. Let your child try to remember the birth dates of all relatives - this will be a great way to train his memory.
How to develop logic in a 12 year old child
To develop logic in a child, you need to conduct intellectual debates with him more often, discuss various books and films. Let the child draw conclusions about the plot he watched or read and its characters; this also trains logic.
A good way to train logical thinking and attention is board games. For example, chess and checkers, Monopoly. Also, a child of 12 years old can already solve Sudoku - this is an excellent option for practicing logic.
Communicate with your children as equals, build trusting relationships with them, discuss social problems, and seek advice. All this will help in the development of your child’s intellectual abilities and give him a good incentive for further growth: this way he will feel like an adult and independent.
